Quick Start#
Display available backend#
from biotransformers import BioTransformers
BioTransformers.list_backend()
>>
* esm1_t34_670M_UR100
* esm1_t6_43M_UR50S
* esm1b_t33_650M_UR50S
* esm_msa1_t12_100M_UR50S
* protbert
* protbert_bfd
Compute embeddings on gpu#
Please refer to the multi-gpus section to have a full understanding of the functionnality.
import ray
sequences = [
"MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
"RSKEPVSGFDLIRDHISQTGMPPTRAEIARSKEPVSGRKGVIEIVSGASRGIRLLQEE",
"MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
"MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
]
ray.init()
bio_trans = BioTransformers(backend="protbert", num_gpus=4)
embeddings = bio_trans.compute_embeddings(sequences, pool_mode=('cls','mean'))
cls_emb = embeddings['cls']
mean_emb = embeddings['mean']
where:
pooling_list: kind of aggregation functions to be used. ‘cls’ return the
<CLS>token embedding used for classification. ‘mean’ will make the mean of all the tokens a sequence.